PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026749m
Common NameCARUB_v10026749mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 336aa    MW: 38113.6 Da    PI: 7.0104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026749mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d++ ++G+g +W + ++++g++R++k+c++rw++yl
  Carubv10026749m 14 KGPWSPEEDVKLKDYIDKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.23.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  Carubv10026749m  69 GGFSEEEDSIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.519962IPR017930Myb domain
SuperFamilySSF466896.53E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-121364IPR001005SANT/Myb domain
PfamPF002492.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-241569IPR009057Homeodomain-like
CDDcd001671.18E-81662No hitNo description
PROSITE profilePS5129421.34963117IPR017930Myb domain
SMARTSM007171.5E-1167115IPR001005SANT/Myb domain
PfamPF002497.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-2370117IPR009057Homeodomain-like
CDDcd001674.35E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDVKLKDYID KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDSIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR  120
QKQMNRQDSM SDSTENNVTN NNNKSPQNLS NSALERLQLH MQLQNLQNPF SSFYNNPILW  180
PKLHPLLQST TTTPNQNSKL ASQESFHPIG LNVDHHENSD IKLSEMNNGV SPLYSENVEQ  240
SLNPAHDFQP NFGFSQDLRL DNHNMELMNR GGSKELFQVG NEFELTNGSS WWSEEVELER  300
KTTSSSSWGS ASVLDQTTEG MVMLQDYAQM SYHSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141177108B-MYB
1h8a_C2e-241411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196400.0AY519640.1 Arabidopsis thaliana MYB transcription factor (At5g57620) mRNA, complete cds.
GenBankBT0303310.0BT030331.1 Arabidopsis thaliana unknown protein (At5g57620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280778.10.0hypothetical protein CARUB_v10026749mg
SwissprotQ9FKL20.0MYB36_ARATH; Transcription factor MYB36
TrEMBLR0EXP20.0R0EXP2_9BRAS; Uncharacterized protein
STRINGscaffold_802340.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.10.0myb domain protein 36